PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v3291390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 164aa    MW: 17363.1 Da    PI: 5.5967
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v3291390.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB107.11.1e-3330893897
            NF-YB 38 cvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                      vsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+++re+ege+
  Lj2g3v3291390.1 30 FVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 89
                     69********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR006154.6E-172745No hitNo description
PfamPF008081.2E-102963IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.15E-2329105IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.7E-293098IPR009072Histone-fold
PRINTSPR006154.6E-174664No hitNo description
PRINTSPR006154.6E-176583No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MADSDNESGG THNAGGNGGE LSSPREQDRF VSEFISFITG EASDKCQREK RKTINGDDLL  60
WAMTTLGFED YVEPLKVYLQ RFREIEGERT VAARDKDSVA ISSSGGGGYE YGAPMGMMMH  120
HQGHVYGSGG FHQVPVTGVS GGAPVMGKGG PGYPSPGSSA GRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A7e-2631844194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B7e-2631844194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A7e-2631844093NF-YB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.84126e-68cell culture| floral bud| flower| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3793981e-40FQ379398.1 Vitis vinifera clone SS0AEB10YI23.
GenBankFQ3897571e-40FQ389757.1 Vitis vinifera clone SS0AEB19YM07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166993.13e-73PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233104e-44NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9VBC01e-72A0A0L9VBC0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S6N11e-72A0A0S3S6N1_PHAAN; Uncharacterized protein
STRINGGLYMA18G08620.17e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-40nuclear factor Y, subunit B3